PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000431358
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family WRKY
Protein Properties Length: 734aa    MW: 79578.9 Da    PI: 6.3863
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000431358genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY101.74.2e-32313370260
                    --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
           WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                    +DgynWrKYGqK+vkgse+prsYY+Ct+++C+vkkkvers+ +++v+ei+Y+g Hnh+k
  MDP0000431358 313 EDGYNWRKYGQKQVKGSEYPRSYYKCTHPNCQVKKKVERSQ-EGHVTEIIYKGAHNHPK 370
                    7****************************************.***************85 PP

2WRKY102.82e-32524582159
                    ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    ldDgy+WrKYGqK+vkg+++prsYY+Ct agC+v+k+ver+++d k v++tYeg+Hnh+
  MDP0000431358 524 LDDGYRWRKYGQKVVKGNPNPRSYYKCTNAGCTVRKHVERASHDLKSVITTYEGKHNHD 582
                    59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081123.204307371IPR003657WRKY domain
SuperFamilySSF1182904.05E-25312371IPR003657WRKY domain
SMARTSM007748.3E-36312370IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.3E-27312371IPR003657WRKY domain
PfamPF031061.1E-24313369IPR003657WRKY domain
Gene3DG3DSA:2.20.25.809.3E-37509584IPR003657WRKY domain
SuperFamilySSF1182901.96E-28516584IPR003657WRKY domain
PROSITE profilePS5081138.32519584IPR003657WRKY domain
SMARTSM007741.9E-37524583IPR003657WRKY domain
PfamPF031067.5E-25525582IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009555Biological Processpollen development
GO:0009942Biological Processlongitudinal axis specification
GO:0030010Biological Processestablishment of cell polarity
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 734 aa     Download sequence    Send to blast
MAGIDDNIAI IGDWVPPSPS PRAFFSSMLV DDIGSRSILE PHXNNRTEDF FLGAREGDNN  60
GKNWSQGNVS GEDITEVGSF PEYKSNSRGG LVERIAARAG FNAPRLNTES IRSSDLSHTS  120
DIRSPYLTIP PGLSPTTLLD SPVFLSNSLA QPSPTTGKFP FASNGHGRSS TLMPESPDKN  180
NFFEDINASF AFKPVAESGS FFLGLTGKMG SGTFQQQSFP SMEVSVQSEN SSQSIEPTKV  240
QXQNTNNLQH QADFSHTSTE KDNGAYTISA DPRAFDTVGG STEHSPPLDE QPDEERGSGD  300
SMAAGGGGGA ASEDGYNWRK YGQKQVKGSE YPRSYYKCTH PNCQVKKKVE RSQEGHVTEI  360
IYKGAHNHPK PPPNRRSAAM GSSNPLVDMR TDIPEQGGAD GDSIWANTQK GNVGGPDWKH  420
DNLEVTSSAS VGPDYCNQSS MQAQNGTHHK SGDVVDASST FSNDEEEDDR GTHGSVSLAY  480
DGEGDESESK RRKIEAYATE MSGATRAIRE PRVVVQTTSE VDILDDGYRW RKYGQKVVKG  540
NPNPRSYYKC TNAGCTVRKH VERASHDLKS VITTYEGKHN HDVPAARNSS HVNSGPSSNM  600
PGQASTIQTH PHRPEPQVHN GMGRFERPSS MGSFNLPGRQ QMGPSHAFSF GMNQPGFANL  660
SMAGLGPGQP KLSVLPSHHP YFAQQRHQVN EMAFMLPKGE PKVEPMSEPG LIMSNGSSVY  720
QQLMSRLPLG PQM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-36313585878Probable WRKY transcription factor 4
2lex_A2e-36313585878Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.168940.0fruit
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00071PBMTransfer from AT5G56270Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ9503670.0KJ950367.1 Pyrus x bretschneideri WRKY domain class transcription factor (WRKY7) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008344758.10.0PREDICTED: probable WRKY transcription factor 2
RefseqXP_008344759.10.0PREDICTED: probable WRKY transcription factor 2
RefseqXP_008344760.10.0PREDICTED: probable WRKY transcription factor 2
SwissprotQ9FG770.0WRKY2_ARATH; Probable WRKY transcription factor 2
TrEMBLA0A089FXL10.0A0A089FXL1_9R
STRINGVIT_19s0015g01870.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95243443
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56270.10.0WRKY DNA-binding protein 2